ZNF573 Peptide - middle region
ZNF573 Peptide - middle region
Product Specifications
UniProt
Q86YE8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF573 Rabbit Polyclonal Antibody (orb575844) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGHLRIHQRVHTGEKPYKCKECGKTFSRRSNLVEHGQFHTDEKPYICEKC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9368649 Inquire
Goose Major Histocompatibility Complex Class II DQ Alpha 2 (MHCDQA2) ELISA Kit
Sign In for Pricing
View Details 
MBS9011778 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) AGP18 Polyclonal Antibody
Sign In for Pricing
View Details 
orb895272 100 µL
Phospho-E2F1 (Ser332) Rabbit Polyclonal Antibody (AP)
Sign In for Pricing
View Details