Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDRD9 Peptide - C-terminal region

TDRD9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf75, HIG-1, NET54

UniProt

Q8NDG6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDRD9 Rabbit Polyclonal Antibody (orb575993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694591

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fbxl7 Pre-designed siRNA Set A
SI204927A 1 Each

Rat Fbxl7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Momordica charantia Lectin (MCL) - Pure
21511432-2 Inquire

Momordica charantia Lectin (MCL) - Pure

Sign In for Pricing
View Details
Rabbit Polyclonal CD55/DAF Antibody [DyLight 680]
NBP2-41295FR 0.1 mL

Rabbit Polyclonal CD55/DAF Antibody [DyLight 680]

Sign In for Pricing
View Details
SARS-Cov2-NP2
553232 100 µg

SARS-Cov2-NP2

Sign In for Pricing
View Details
Recombinant Magnetospirillum magneticum ATP phosphoribosyltransferase (hisG)
MBS1409991-01 0.02 mg (E-Coli)

Recombinant Magnetospirillum magneticum ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Magnetospirillum magneticum ATP phosphoribosyltransferase (hisG)
MBS1409991-02 0.1 mg (E-Coli)

Recombinant Magnetospirillum magneticum ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details