TDRD9 Peptide - C-terminal region
TDRD9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C14orf75, HIG-1, NET54
UniProt
Q8NDG6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TDRD9 Rabbit Polyclonal Antibody (orb575993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_694591
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6147753-01 0.1 mL
IL17B (Interleukin-17B, IL-17B, Cytokine Zcyto7, Interleukin-20, IL-20, Neuronal Interleukin-17-related Factor, IL20, NIRF, ZCYTO7, UNQ516/PRO1031) (FITC)
Sign In for Pricing
View Details MBS6147753-02 5x 0.1 mL
IL17B (Interleukin-17B, IL-17B, Cytokine Zcyto7, Interleukin-20, IL-20, Neuronal Interleukin-17-related Factor, IL20, NIRF, ZCYTO7, UNQ516/PRO1031) (FITC)
Sign In for Pricing
View Details 
MBS1199530-01 0.02 mg (E-Coli)
Recombinant Pseudomonas aeruginosa Quinone oxidoreductase (qor)
Sign In for Pricing
View Details MBS1199530-02 0.02 mg (Yeast)
Recombinant Pseudomonas aeruginosa Quinone oxidoreductase (qor)
Sign In for Pricing
View Details