Irf5 Peptide - middle region
Irf5 Peptide - middle region
Product Specifications
UniProt
B2CC69
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IRF5 Rabbit Polyclonal Antibody (orb329911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1658634 96 Tests
Rat Estrogen sulfotransferase, isoform 3 ELISA Kit
Sign In for Pricing
View Details 
LV657323 1.0 µg DNA
EN2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details