Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf7l Peptide - C-terminal region

Taf7l Peptide - C-terminal region

Product Specifications

Product Name Alternative

4933438I11Rik, 50kDa, Taf2q

UniProt

Q9D3R9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf7l Rabbit Polyclonal Antibody (orb329920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083234

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHMT2/G9A (EHMT2) Human siRNA Oligo Duplex (Locus ID 10919)
SR307452 1 Kit

EHMT2/G9A (EHMT2) Human siRNA Oligo Duplex (Locus ID 10919)

Sign In for Pricing
View Details
Licoricesaponin G2
BUP00323-01 1 mg

Licoricesaponin G2

Sign In for Pricing
View Details
Licoricesaponin G2
BUP00323-02 5 mg

Licoricesaponin G2

Sign In for Pricing
View Details
Licoricesaponin G2
BUP00323-03 10 mg

Licoricesaponin G2

Sign In for Pricing
View Details
Licoricesaponin G2
BUP00323-04 25 mg

Licoricesaponin G2

Sign In for Pricing
View Details
Pig Perilipin-2 ELISA Kit
MBS288166-01 48 Well

Pig Perilipin-2 ELISA Kit

Sign In for Pricing
View Details