Taf7l Peptide - C-terminal region
Taf7l Peptide - C-terminal region
Product Specifications
Product Name Alternative
4933438I11Rik, 50kDa, Taf2q
UniProt
Q9D3R9
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Taf7l Rabbit Polyclonal Antibody (orb329920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_083234
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
126184-AP 100 µL
EFHC1 (EF-hand Domain-containing Protein 1, Myoclonin-1, FLJ10466, FLJ37290) (AP) discontinued
Sign In for Pricing
View Details 
CEIK-099L 10 Tests
ExoQualiTM Human Exosome Capture and Isolation Kits (for Cell Culture Media/ Urine) (CD81 Capture Beads)
Sign In for Pricing
View Details E4301-100 100 Assays
Dihydrofolate reductase (DHFR) (Human) ELISA Kit
Sign In for Pricing
View Details 037456-FITC 200 µL
KIR2DL2, CT (KIR2DL2, CD158B1, NKAT6, Killer cell immunoglobulin-like receptor 2DL2, CD158 antigen-like family member B1, MHC class I NK cell receptor, Natural killer-associated transcript 6, p58 natural killer cell receptor clone CL-43, CD158b1) (FITC) discontinued
Sign In for Pricing
View Details