Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP8 Peptide - middle region

SP8 Peptide - middle region

Product Specifications

UniProt

Q4G0T0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Water Washout Resistance Tester BPTL-225
BPTL-225 1 Unit

Water Washout Resistance Tester BPTL-225

Sign In for Pricing
View Details
IL 12 p40 Human Baculovirus
OM296748-01 10 µg

IL 12 p40 Human Baculovirus

Sign In for Pricing
View Details
IL 12 p40 Human Baculovirus
OM296748-02 2 µg

IL 12 p40 Human Baculovirus

Sign In for Pricing
View Details
IL 12 p40 Human Baculovirus
OM296748-03 1 mg

IL 12 p40 Human Baculovirus

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (SOX10/2311R), CF594 conjugate, 0.1mg/mL
BNC942311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), CF488A conjugate, 0.1mg/mL
BNC880767-500 1x 500 µL

GnRH-Receptor (LHRH Receptor) (F1G4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details