Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP8 Peptide - middle region

SP8 Peptide - middle region

Product Specifications

UniProt

Q4G0T0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LRG1 Protein (Fc & His Tag)
PKSH032693-01 10 µg

Recombinant Human LRG1 Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Human LRG1 Protein (Fc & His Tag)
PKSH032693-02 50 µg

Recombinant Human LRG1 Protein (Fc & His Tag)

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF405S conjugate, 0.1mg/mL
BNC041461-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/2122), CF405S conjugate, 0.1mg/mL
BNC042122-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/2122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Cellotriose Undecaacetate
TRC-C255950-50MG 50 mg

D-Cellotriose Undecaacetate

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF405S conjugate, 0.1mg/mL
BNC042026-500 1x 500 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details