Zfp148 Peptide - N-terminal region
Zfp148 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2210405J08Rik, AI480666, AW045217, BERF-1, BFCOL1, ZBP-89, Znf148
UniProt
Q548L0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zfp148 Rabbit Polyclonal Antibody (orb324804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035879
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550525-100 1x 100 µL
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940029-100 1x 100 µL
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051037-100 1x 100 µL
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details