Tbx18 Peptide - N-terminal region
Tbx18 Peptide - N-terminal region
Product Specifications
UniProt
D4A1V6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tbx18 Rabbit Polyclonal Antibody (orb577450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GPARSCTDAERSCASRGPAGSCEDGFLQGASPLASPGGSPKGSPVPGLAR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941037-500 1x 500 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details