Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIS3 Peptide - N-terminal region

DIS3 Peptide - N-terminal region

Product Specifications

UniProt

F2Z2C0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DIS3 Rabbit Polyclonal Antibody (orb577776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGENA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kidney Injury Molecule 1 ELISA Kit (Kim1)
RK01725 96 Tests

Human Kidney Injury Molecule 1 ELISA Kit (Kim1)

Sign In for Pricing
View Details
Lentiviral mouse Cdca4 shRNA (UAS) - Lentiviral mouse Cdca4 shRNA (UAS) (100)
GTR15280902 1 Vial

Lentiviral mouse Cdca4 shRNA (UAS) - Lentiviral mouse Cdca4 shRNA (UAS) (100)

Sign In for Pricing
View Details
UACA Antibody
orb388572-01 20 µg

UACA Antibody

Sign In for Pricing
View Details
UACA Antibody
orb388572-02 100 µg

UACA Antibody

Sign In for Pricing
View Details
UACA Antibody
orb388572-03 100 ug (without BSA and Azide)

UACA Antibody

Sign In for Pricing
View Details
CTNNA2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0527005 3x 1.0 µg

CTNNA2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details