Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPI Peptide - N-terminal region

CENPI Peptide - N-terminal region

Product Specifications

UniProt

Q92674

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CENPI Rabbit Polyclonal Antibody (orb582491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-6-fluorobenzenesulfonamide
PC99613 1 Each

2-Chloro-6-fluorobenzenesulfonamide

Sign In for Pricing
View Details
Rabbit Polyclonal V-type proton ATPase subunit F Antibody [DyLight 488]
NBP2-97084G 0.1 mL

Rabbit Polyclonal V-type proton ATPase subunit F Antibody [DyLight 488]

Sign In for Pricing
View Details
CD9 Antibody
orb3053640-01 50 µL

CD9 Antibody

Sign In for Pricing
View Details
CD9 Antibody
orb3053640-02 100 µL

CD9 Antibody

Sign In for Pricing
View Details
MNK1 (MKNK1) (NM_003684) Human Untagged Clone
SC323330 10 µg

MNK1 (MKNK1) (NM_003684) Human Untagged Clone

Sign In for Pricing
View Details
Human MS4A6A (NP_690591) VersaClone cDNA
RDC0386 10 µg

Human MS4A6A (NP_690591) VersaClone cDNA

Sign In for Pricing
View Details