Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPI Peptide - N-terminal region

CENPI Peptide - N-terminal region

Product Specifications

UniProt

Q92674

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CENPI Rabbit Polyclonal Antibody (orb582491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THOC1 Protein Vector (Human) (pPM-C-HA)
46657021 500 ng

THOC1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
C7 Antibody
MBS9507400-01 0.05 mL

C7 Antibody

Sign In for Pricing
View Details
C7 Antibody
MBS9507400-02 0.1 mL

C7 Antibody

Sign In for Pricing
View Details
C7 Antibody
MBS9507400-03 5x 0.1 mL

C7 Antibody

Sign In for Pricing
View Details
PLEKHH3 Antibody - N-terminal region
OAGA06164-100UL 100 µL

PLEKHH3 Antibody - N-terminal region

Sign In for Pricing
View Details
Picroside IV
AB1308 10 mg

Picroside IV

Sign In for Pricing
View Details