KRT87P Peptide - middle region
KRT87P Peptide - middle region
Product Specifications
Product Name Alternative
KRT121P, KRTHBP4
UniProt
A6NCN2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KRT87P Rabbit Polyclonal Antibody (orb582744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038570-APC 200 µL
MPPE1, CT (MPPE1, PGAP5, Metallophosphoesterase 1, Post-GPI attachment to proteins factor 5) (APC) discontinued
Sign In for Pricing
View Details orb2916340-01 20 µg
Recombinant Staphylococcus aureus Prolipoprotein diacylglyceryl transferase (lgt)
Sign In for Pricing
View Details orb2916340-02 100 µg
Recombinant Staphylococcus aureus Prolipoprotein diacylglyceryl transferase (lgt)
Sign In for Pricing
View Details 