Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf216 Peptide - N-terminal region

Rnf216 Peptide - N-terminal region

Product Specifications

UniProt

P58283

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnf216 Rabbit Polyclonal Antibody (orb583731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Electronic Pipette
21011612 1 PC

Electronic Pipette

Sign In for Pricing
View Details
Isobutylene sulfide
OR1044036 500 mg

Isobutylene sulfide

Sign In for Pricing
View Details
Human Matrix Metalloproteinase 28 (MMP28) ELISA Kit
RDR-MMP28-Hu-48Tests 48 Tests

Human Matrix Metalloproteinase 28 (MMP28) ELISA Kit

Sign In for Pricing
View Details
TMM-COL-GY-PK AB Labels
054627 Pack of 2700 Label(s)

TMM-COL-GY-PK AB Labels

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 7, Brain (FABP7)
MBS2053435-01 0.1 mL

HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 7, Brain (FABP7)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 7, Brain (FABP7)
MBS2053435-02 0.2 mL

HRP-Linked Polyclonal Antibody to Fatty Acid Binding Protein 7, Brain (FABP7)

Sign In for Pricing
View Details