Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf216 Peptide - N-terminal region

Rnf216 Peptide - N-terminal region

Product Specifications

UniProt

P58283

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnf216 Rabbit Polyclonal Antibody (orb583731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein TANC2 (TANC2) ELISA Kit
KTE60466-01 48 Tests

Human Protein TANC2 (TANC2) ELISA Kit

Sign In for Pricing
View Details
Human Protein TANC2 (TANC2) ELISA Kit
KTE60466-02 96 Tests

Human Protein TANC2 (TANC2) ELISA Kit

Sign In for Pricing
View Details
Human Protein TANC2 (TANC2) ELISA Kit
KTE60466-03 5x 96 Tests

Human Protein TANC2 (TANC2) ELISA Kit

Sign In for Pricing
View Details
Human Protein TANC2 (TANC2) ELISA Kit
KTE60466-04 50x 96 Tests

Human Protein TANC2 (TANC2) ELISA Kit

Sign In for Pricing
View Details
ZNF175 Antibody
orb239763-01 50 µg

ZNF175 Antibody

Sign In for Pricing
View Details
ZNF175 Antibody
orb239763-02 100 µg

ZNF175 Antibody

Sign In for Pricing
View Details