Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRA1 Peptide - C-terminal region

ADGRA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR123

UniProt

Q86SQ6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRA1 Rabbit Polyclonal Antibody (orb584478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) SED5 Polyclonal Antibody
MBS7145658 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) SED5 Polyclonal Antibody

Sign In for Pricing
View Details
Semaphorin 3E (SEMA3E) BioAssayTM ELISA Kit (Mouse)
028019 96 Tests

Semaphorin 3E (SEMA3E) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal Glucokinase/GCK Antibody (4K9D5)
NBP3-16579-100ul 100 µL

Rabbit Monoclonal Glucokinase/GCK Antibody (4K9D5)

Sign In for Pricing
View Details
NIF3L1 Conjugated Antibody
orb1621936 100 µL

NIF3L1 Conjugated Antibody

Sign In for Pricing
View Details
FEZ1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb877823 100 µL

FEZ1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
USH1E CRISPR All-in-one AAV vector set (with saCas9)(Human)
49260151 3x 1.0 µg DNA

USH1E CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details