Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGRA1 Peptide - C-terminal region

ADGRA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR123

UniProt

Q86SQ6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADGRA1 Rabbit Polyclonal Antibody (orb584478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc5a5 (NM_052983) Rat Untagged Clone
RN213291 10 µg

Slc5a5 (NM_052983) Rat Untagged Clone

Sign In for Pricing
View Details
Phospho-PRKCA (T638) Recombinant Antibody [3A5] (OACA12201)
OACA12201-100UL 100 µL

Phospho-PRKCA (T638) Recombinant Antibody [3A5] (OACA12201)

Sign In for Pricing
View Details
SRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) (MaxLight 490) discontinued
R1076-05A-ML490 100 µL

SRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) (MaxLight 490) discontinued

Sign In for Pricing
View Details
PSCDBP antibody
orb73614 100 µL

PSCDBP antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Myosin heavy chain 11 Antibody (8A8J4)
NBP3-16323-100ul 100 µL

Rabbit Monoclonal Myosin heavy chain 11 Antibody (8A8J4)

Sign In for Pricing
View Details
Gm7092 3'UTR Luciferase Stable Cell Line
TU108529 1.0 mL

Gm7092 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details