Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSC Peptide - N-terminal region

CTSC Peptide - N-terminal region

Product Specifications

UniProt

P53634

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSC Rabbit Polyclonal Antibody (orb331087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP (Alpha Fetoprotein) (MBS-12), CF740 conjugate, 0.1mg/mL
BNC740521-500 1x 500 µL

AFP (Alpha Fetoprotein) (MBS-12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)
PDMM100151-01 20 µg

Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)
PDMM100151-02 100 µg

Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)
PDMM100151-03 500 µg

Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)
PDMM100151-04 1 mg

Recombinant Mouse Chitinase 3-like 1 Protein (His Tag)

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053), CF555 conjugate, 0.1mg/mL
BNC550681-500 1x 500 µL

Human Kappa Light Chain (HP6053), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details