CTSC Peptide - N-terminal region
CTSC Peptide - N-terminal region
Product Specifications
UniProt
P53634
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CTSC Rabbit Polyclonal Antibody (orb331087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401198-500 1x 500 µL
Cytokeratin 7 (KRT7/1198), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682155-100 1x 100 µL
Catenin, gamma (Cardiomyocyte Marker) (CTNG/2155R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
FA-2305-1 1 mL
FITC Conjugated Goat Polyclonal Antibody to Monkey IgG
Sign In for Pricing
View Details 