TBRG1 Peptide - C-terminal region
TBRG1 Peptide - C-terminal region
Product Specifications
UniProt
Q3YBR2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBRG1 Rabbit Polyclonal Antibody (orb584745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![(E)-3-(2-Fluorophenyl)-N-((S)-1-(3,4-dihydro-2H-benzo[1,4]oxazin-6-yl)-ethyl]acrylamide](https://cdn.genprice.uk/products/572/7651987299957/imageurl/trc-f595708-2mg.webp)
TRC-F595708-2MG 2 mg
(E)-3-(2-Fluorophenyl)-N-((S)-1-(3,4-dihydro-2H-benzo[1,4]oxazin-6-yl)-ethyl]acrylamide
Sign In for Pricing
View Details 
