ZDHHC12 Peptide - N-terminal region
ZDHHC12 Peptide - N-terminal region
Product Specifications
UniProt
Q96GR4
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZDHHC12 Rabbit Polyclonal Antibody (orb326366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I-2402-1 1 mg
Ferritin Conjugated Griffonia simplicifolia Lectin -GS-II-
Sign In for Pricing
View Details 
BNC041725-100 1x 100 µL
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 