Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA16 Peptide - C-terminal region

IFNA16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IFN-alphaO

UniProt

P05015

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNA16 Rabbit Polyclonal Antibody (orb584774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002164

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF14 Rabbit Polyclonal Antibody
TA369126 100 µL

FGF14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Actin Rabbit polyclonal Antibody
HA500552 100 µL

Actin Rabbit polyclonal Antibody

Sign In for Pricing
View Details
KLHL10 Human Gene Knockout Kit (CRISPR)
KN422526 1 Kit

KLHL10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Cervix
CB526412 1 Block

Frozen Tissue Blocks, Cervix

Sign In for Pricing
View Details
AI413582 (BC028464) Mouse Tagged ORF Clone
MG200102 10 µg

AI413582 (BC028464) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
C7orf66 (NM_001024607) Human Recombinant Protein
TP761723 50 µg

C7orf66 (NM_001024607) Human Recombinant Protein

Sign In for Pricing
View Details