IFNA16 Peptide - C-terminal region
IFNA16 Peptide - C-terminal region
Product Specifications
Product Name Alternative
IFN-alphaO
UniProt
P05015
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IFNA16 Rabbit Polyclonal Antibody (orb584774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002164
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Cytokeratin 19 Recombinant Rabbit monoclonal Antibody [SA30-06]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82c3b/imageurl/et1601-6-50ul.webp)
ET1601-6-50UL 50 µL
Cytokeratin 19 Recombinant Rabbit monoclonal Antibody [SA30-06]
Sign In for Pricing
View Details 
BNC400763-100 1x 100 µL
CD34 (HPCA1/763), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details