Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GET4 Peptide - C-terminal region

GET4 Peptide - C-terminal region

Product Specifications

UniProt

Q7L5D6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GET4 Rabbit Polyclonal Antibody (orb326388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-Bromoaniline 97%
B18510-01 25 g

P-Bromoaniline 97%

Sign In for Pricing
View Details
P-Bromoaniline 97%
B18510-02 100 g

P-Bromoaniline 97%

Sign In for Pricing
View Details
P-Bromoaniline 97%
B18510-03 500 g

P-Bromoaniline 97%

Sign In for Pricing
View Details
IKBKG Polyclonal Antibody
MBS2521693-01 0.02 mL

IKBKG Polyclonal Antibody

Sign In for Pricing
View Details
IKBKG Polyclonal Antibody
MBS2521693-02 0.06 mL

IKBKG Polyclonal Antibody

Sign In for Pricing
View Details
IKBKG Polyclonal Antibody
MBS2521693-03 0.12 mL

IKBKG Polyclonal Antibody

Sign In for Pricing
View Details