Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GET4 Peptide - C-terminal region

GET4 Peptide - C-terminal region

Product Specifications

UniProt

Q7L5D6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GET4 Rabbit Polyclonal Antibody (orb326388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCB Rabbit Monoclonal Antibody
E10G21381 100 µL

FANCB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
4933422H20Rik Recombinant Protein (Mouse)
RP112331 100 µg

4933422H20Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Tetraheptylammonium bromide
FT13269-01 50 g

Tetraheptylammonium bromide

Sign In for Pricing
View Details
Tetraheptylammonium bromide
FT13269-02 100 g

Tetraheptylammonium bromide

Sign In for Pricing
View Details
Tetraheptylammonium bromide
FT13269-03 250 g

Tetraheptylammonium bromide

Sign In for Pricing
View Details
Tetraheptylammonium bromide
FT13269-04 500 g

Tetraheptylammonium bromide

Sign In for Pricing
View Details