SPTBN1 Peptide - C-terminal region
SPTBN1 Peptide - C-terminal region
Product Specifications
UniProt
B4DIF8
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPTBN1 Rabbit Polyclonal Antibody (orb585129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC473229-500 1x 500 µL
Prohibitin (Mitochondrial Marker) (PHB/3229), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA750013 100 µL
Alkaline Phosphatase Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
