Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPTBN1 Peptide - C-terminal region

SPTBN1 Peptide - C-terminal region

Product Specifications

UniProt

B4DIF8

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPTBN1 Rabbit Polyclonal Antibody (orb585129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKHEVSASTQSTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Platelet Derived Growth Factor Subunit B (PDGFB) ELISA Kit
RD-PDGFB-Mu-01 96 Tests

Mouse Platelet Derived Growth Factor Subunit B (PDGFB) ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor Subunit B (PDGFB) ELISA Kit
RD-PDGFB-Mu-02 48 Tests

Mouse Platelet Derived Growth Factor Subunit B (PDGFB) ELISA Kit

Sign In for Pricing
View Details
CD93 Mouse Monoclonal Antibody [Clone ID: mNI-11]
AM26516AF-N 100 µg

CD93 Mouse Monoclonal Antibody [Clone ID: mNI-11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS636266 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
Human BTBD11 activation kit by CRISPRa
GA114756 1 Kit

Human BTBD11 activation kit by CRISPRa

Sign In for Pricing
View Details
ITPR2 Polyclonal Antibody
E-AB-52051-01 20 µL

ITPR2 Polyclonal Antibody

Sign In for Pricing
View Details