Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR2A Peptide - N-terminal region

POLR2A Peptide - N-terminal region

Product Specifications

UniProt

Q6NX41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLR2A Rabbit Polyclonal Antibody (orb585201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA4 Human Gene Knockout Kit (CRISPR)
KN210945RB 1 Kit

GATA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sting1 Mouse Gene Knockout Kit (CRISPR)
KN317757LP 1 Kit

Sting1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE2R4 Antibody
8G099-AAT 50 µg

PE2R4 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS500009 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
2-Amino-5-nitrophenol
TRC-A580130-50G 50 g

2-Amino-5-nitrophenol

Sign In for Pricing
View Details
Mouse Aip activation kit by CRISPRa
GA200138 1 Kit

Mouse Aip activation kit by CRISPRa

Sign In for Pricing
View Details