POLR2A Peptide - N-terminal region
POLR2A Peptide - N-terminal region
Product Specifications
UniProt
Q6NX41
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLR2A Rabbit Polyclonal Antibody (orb585201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Thioredoxin 2 Recombinant Rabbit Monoclonal Antibody [JE35-76]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81d85/imageurl/ha722142.webp)
HA722142 100 µL
Thioredoxin 2 Recombinant Rabbit Monoclonal Antibody [JE35-76]
Sign In for Pricing
View Details 
TA379297 100 µL
Glucocorticoid Receptor (NR3C1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details