CDC37L1 Peptide - N-terminal region
CDC37L1 Peptide - N-terminal region
Product Specifications
UniProt
B1AL69
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDC37L1 Rabbit Polyclonal Antibody (orb331187) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041175-500 1x 500 µL
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![PE/Cyanine5.5 Anti-Human CD161 Antibody[HP-3G10]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d412d/imageurl/e-ab-f1155i.webp)
E-AB-F1155I-01 20 Tests
PE/Cyanine5.5 Anti-Human CD161 Antibody[HP-3G10]
Sign In for Pricing
View Details E-AB-F1155I-02 100 Tests
PE/Cyanine5.5 Anti-Human CD161 Antibody[HP-3G10]
Sign In for Pricing
View Details E-AB-F1155I-03 2x 100 Tests
PE/Cyanine5.5 Anti-Human CD161 Antibody[HP-3G10]
Sign In for Pricing
View Details