HEATR9 Peptide - middle region
HEATR9 Peptide - middle region
Product Specifications
Product Name Alternative
C17orf66
UniProt
A2RTY3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HEATR9 Rabbit Polyclonal Antibody (orb585548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AILGCLNKHVIRALIKQLKEKNEGQRMETLTGLRMALNSWAAVSKDKRTQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
218644-01 100 µg
TPST1, Recombinant, Human, aa26-370, His-Tag (Protein-Tyrosine Sulfotransferase 1)
Sign In for Pricing
View Details 218644-02 500 µg
TPST1, Recombinant, Human, aa26-370, His-Tag (Protein-Tyrosine Sulfotransferase 1)
Sign In for Pricing
View Details 