HEATR9 Peptide - middle region
HEATR9 Peptide - middle region
Product Specifications
Product Name Alternative
C17orf66
UniProt
A2RTY3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HEATR9 Rabbit Polyclonal Antibody (orb585548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AILGCLNKHVIRALIKQLKEKNEGQRMETLTGLRMALNSWAAVSKDKRTQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6472051-01 0.1 mL
MCK10 (Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyrosine Kinase RTK-6, HGK2, CD167 Antigen-like Family Me
Sign In for Pricing
View Details MBS6472051-02 5x 0.1 mL
MCK10 (Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyrosine Kinase RTK-6, HGK2, CD167 Antigen-like Family Me
Sign In for Pricing
View Details 
P9078-25E-ML650 100 µL
PSMD4, CT (26S Proteasome Non-ATPase Regulatory Subunit 4, 26S Proteasome Regulatory Subunit S5A, 26S Proteasome Regulatory Subunit RPN10, Multiubiquitin Chain-binding Protein, Antisecretory Factor 1) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
K3504203 1.0 µg DNA
Lysmd4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details