VEGFC Peptide - C-terminal region
VEGFC Peptide - C-terminal region
Product Specifications
Product Name Alternative
Flt4-L, VRP
UniProt
P49767
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VEGFC Rabbit Polyclonal Antibody (orb585558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005420
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA392919 100 µL
Cardiac Troponin I (TNNI3) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
