Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK2 Peptide - C-terminal region

PANK2 Peptide - C-terminal region

Product Specifications

UniProt

Q9BZ23

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PANK2 Rabbit Polyclonal Antibody (orb585772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOX3, NT (NOX3, MOX2, NADPH oxidase 3, Mitogenic oxidase 2, gp91phox homolog 3) (Biotin) discontinued
039071-Biotin 200 µL

NOX3, NT (NOX3, MOX2, NADPH oxidase 3, Mitogenic oxidase 2, gp91phox homolog 3) (Biotin) discontinued

Sign In for Pricing
View Details
Dhx8 (NM_144831) Mouse Untagged Clone
MC224038 10 µg

Dhx8 (NM_144831) Mouse Untagged Clone

Sign In for Pricing
View Details
PPIL1 Polyclonal Antibody, HRP Conjugated
bs-2398R-HRP 100 µL

PPIL1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Anti-MICAL2 Antibody
CQA8711-01 30 µL

Anti-MICAL2 Antibody

Sign In for Pricing
View Details
Anti-MICAL2 Antibody
CQA8711-02 50 μL

Anti-MICAL2 Antibody

Sign In for Pricing
View Details
Anti-MICAL2 Antibody
CQA8711-03 100 µL

Anti-MICAL2 Antibody

Sign In for Pricing
View Details