Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK2 Peptide - C-terminal region

PANK2 Peptide - C-terminal region

Product Specifications

UniProt

Q9BZ23

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PANK2 Rabbit Polyclonal Antibody (orb585772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Left-Right Determination Factor 1 Human Recombinant
rAP-3531 1 Each

Left-Right Determination Factor 1 Human Recombinant

Sign In for Pricing
View Details
EPCR Protein, Human, Recombinant (hFc Tag)
E45H52114M4-50 50 µg

EPCR Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details
β-1,4-GalNAc-T3 shRNA (m) Lentiviral Particles
sc-108230-V 200 µL

β-1,4-GalNAc-T3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Uridine Phosphorylase Salmonella Typhimurium Recombinant (UPP1 Salmonella)
PT_42360-01 10 µg

Uridine Phosphorylase Salmonella Typhimurium Recombinant (UPP1 Salmonella)

Sign In for Pricing
View Details
Uridine Phosphorylase Salmonella Typhimurium Recombinant (UPP1 Salmonella)
PT_42360-02 50 µg

Uridine Phosphorylase Salmonella Typhimurium Recombinant (UPP1 Salmonella)

Sign In for Pricing
View Details
Uridine Phosphorylase Salmonella Typhimurium Recombinant (UPP1 Salmonella)
PT_42360-03 1 mg

Uridine Phosphorylase Salmonella Typhimurium Recombinant (UPP1 Salmonella)

Sign In for Pricing
View Details