Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMF1 Peptide - N-terminal region

SUMF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AAPA3037, FGE

UniProt

Q8NBK3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUMF1 Rabbit Polyclonal Antibody (orb331269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_877437

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY 123502
MBS5777572 Inquire

LY 123502

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) Spike RBD Monoclonal Antibody [B001] (Biotin)
orb1274011 0.1 mg

SARS-CoV-2 (COVID-19) Spike RBD Monoclonal Antibody [B001] (Biotin)

Sign In for Pricing
View Details
ZNF764 Rabbit pAb
E47R20837 100 µL

ZNF764 Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal OR5J2 Antibody
NBP2-31771 0.1 mL

Rabbit Polyclonal OR5J2 Antibody

Sign In for Pricing
View Details
Human SOX10 Alexa Fluor 750 MAb (2447A)
IC28642S-100UG 100 µg

Human SOX10 Alexa Fluor 750 MAb (2447A)

Sign In for Pricing
View Details
CYP27A1 Rabbit Polyclonal Antibody (Biotin)
orb2110360 100 µL

CYP27A1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details