Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMF1 Peptide - N-terminal region

SUMF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AAPA3037, FGE

UniProt

Q8NBK3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUMF1 Rabbit Polyclonal Antibody (orb331269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_877437

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp4b (NM_012510) Rat Tagged Lenti ORF Clone
RR201017L3 10 µg

Atp4b (NM_012510) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APC Anti-Human CD15 (HI98)
APC-30060-01 50 Tests

APC Anti-Human CD15 (HI98)

Sign In for Pricing
View Details
APC Anti-Human CD15 (HI98)
APC-30060-02 100 Tests

APC Anti-Human CD15 (HI98)

Sign In for Pricing
View Details
CYorf15A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0549106 1.0 µg DNA

CYorf15A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
EEF1E1 (NM_004280) Human Tagged ORF Clone Lentiviral Particle
RC202732L4V 200 µL

EEF1E1 (NM_004280) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-{[ (Furan-2-yl) methyl]amino}pyridine-4-carboxylic acid
LIC60286-01 50 mg

3-{[ (Furan-2-yl) methyl]amino}pyridine-4-carboxylic acid

Sign In for Pricing
View Details