S1PR2 Peptide - N-terminal region
S1PR2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AGR16, EDG-5, EDG5, Gpcr13, H218, LPB2, S1P2
UniProt
O95136
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with S1PR2 Rabbit Polyclonal Antibody (orb331298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004221
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP304970M 100 µg
Lamin A (LMNA) (NM_170707) Human Recombinant Protein
Sign In for Pricing
View Details 
![HIBCH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F6]](https://cdn.genprice.uk/products/937/68dd1b66061270361ea1490b/imageurl/ta501332bm.webp)
TA501332BM 100 µL
HIBCH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F6]
Sign In for Pricing
View Details 
BNC040950-100 1x 100 µL
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details