Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYFIP1 Peptide - C-terminal region

CYFIP1 Peptide - C-terminal region

Product Specifications

UniProt

Q7L576

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Lymphoid tissue
CP565768 150 µg

Tissue Protein Lysate, Lymphoid tissue

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS710630 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
(Z)-1-Chloro-2-nonene
TRC-C369775-25MG 25 mg

(Z)-1-Chloro-2-nonene

Sign In for Pricing
View Details
DDR2 (NM_001014796) Human Recombinant Protein
TP308745 20 µg

DDR2 (NM_001014796) Human Recombinant Protein

Sign In for Pricing
View Details
HMG20A Mouse Monoclonal Antibody [Clone ID: OTI5E4]
CF807000 100 µg

HMG20A Mouse Monoclonal Antibody [Clone ID: OTI5E4]

Sign In for Pricing
View Details
Ethyl Levulinate
TRC-E921965-250G 250 g

Ethyl Levulinate

Sign In for Pricing
View Details