Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYFIP1 Peptide - C-terminal region

CYFIP1 Peptide - C-terminal region

Product Specifications

UniProt

Q7L576

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRF/LAR Rabbit Polyclonal Antibody
R1510-12 100 µL

PTPRF/LAR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rad6 (UBE2A) (NM_003336) Human Over-expression Lysate
LY418754 100 µg

Rad6 (UBE2A) (NM_003336) Human Over-expression Lysate

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF594 conjugate, 0.1mg/mL
BNC942924-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Universal Spring Platform
H1000-P-SP 1 Each

Universal Spring Platform

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF740 conjugate, 0.1mg/mL
BNC742886-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERK1 (MAPK3) (NM_001109891) Human Over-expression Lysate
LY426307 100 µg

ERK1 (MAPK3) (NM_001109891) Human Over-expression Lysate

Sign In for Pricing
View Details