DCLK1 Peptide - C-terminal region
DCLK1 Peptide - C-terminal region
Product Specifications
UniProt
Q5VZY9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DCLK1 Rabbit Polyclonal Antibody (orb586098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPGPSR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM041276-01 10 µg
Recombinant Mouse TIM-3/HAVCR2 Protein (aa 20-191, His Tag)
Sign In for Pricing
View Details PKSM041276-02 50 µg
Recombinant Mouse TIM-3/HAVCR2 Protein (aa 20-191, His Tag)
Sign In for Pricing
View Details 
