Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATL3 Peptide - middle region

ATL3 Peptide - middle region

Product Specifications

UniProt

F5H6I7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATL3 Rabbit Polyclonal Antibody (orb586103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKVAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCK8 Rabbit pAb, Pacific Blue conjugated
orb2848257 100 µL

CCK8 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)
TRV-0043779-01 24 Tests

ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)

Sign In for Pricing
View Details
ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)
TRV-0043779-02 48 Tests

ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)

Sign In for Pricing
View Details
ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)
TRV-0043779-03 96 Tests

ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)

Sign In for Pricing
View Details
ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)
TRV-0043779-04 5x 96 Tests

ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)

Sign In for Pricing
View Details
ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)
TRV-0043779-05 10x 96 Tests

ELISA Kit for Inter Alpha-Globulin Inhibitor H4 (ITIH4)

Sign In for Pricing
View Details