Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMO2 Peptide - N-terminal region

LMO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBTN2, RBTNL1, RHOM2, TTG2

UniProt

P25791

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMO2 Rabbit Polyclonal Antibody (orb573699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005565

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]
E-AB-F1267H-01 20 Tests

PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]
E-AB-F1267H-02 100 Tests

PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]
E-AB-F1267H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD66b Antibody[G10F5]

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), CF568 conjugate, 0.1mg/mL
BNC680892-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL19 (NM_013371) Human Recombinant Protein
TP312571L 1 mg

IL19 (NM_013371) Human Recombinant Protein

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF640R conjugate, 0.1mg/mL
BNC400880-100 1x 100 µL

P57 / KIP2 (KIP2/880), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details