Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMO2 Peptide - N-terminal region

LMO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBTN2, RBTNL1, RHOM2, TTG2

UniProt

P25791

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMO2 Rabbit Polyclonal Antibody (orb573699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005565

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta IV TubuLin (TUBB4A) (NM_006087) Human Over-expression Lysate
LC401833 20 µg

beta IV TubuLin (TUBB4A) (NM_006087) Human Over-expression Lysate

Sign In for Pricing
View Details
Detomidine Hydrochloride
TRC-D297975-10MG 10 mg

Detomidine Hydrochloride

Sign In for Pricing
View Details
TGFalpha (MF9), CF640R conjugate, 0.1mg/mL
BNC400644-100 1x 100 µL

TGFalpha (MF9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Chic1 activation kit by CRISPRa
GA200443 1 Kit

Mouse Chic1 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Thiazolesulfonyl Chloride
TRC-T344225-50MG 50 mg

2-Thiazolesulfonyl Chloride

Sign In for Pricing
View Details
Butylamine Hydrochloride
TRC-B693120-5G 5 g

Butylamine Hydrochloride

Sign In for Pricing
View Details