Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM29 Peptide - C-terminal region

TRIM29 Peptide - C-terminal region

Product Specifications

UniProt

B7Z8U9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM29 Rabbit Polyclonal Antibody (orb573920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA7 (NM_031942) Human Over-expression Lysate
LC429791 20 µg

CDCA7 (NM_031942) Human Over-expression Lysate

Sign In for Pricing
View Details
GATA4 (NM_002052) Human Recombinant Protein
TP310945M 100 µg

GATA4 (NM_002052) Human Recombinant Protein

Sign In for Pricing
View Details
Epac2 (RAPGEF4) Rabbit Monoclonal Antibody
TA423640 100 µL

Epac2 (RAPGEF4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SOX4 Antibody
KC-24984-01 50 μL

SOX4 Antibody

Sign In for Pricing
View Details
SOX4 Antibody
KC-24984-02 100 µL

SOX4 Antibody

Sign In for Pricing
View Details
SOX4 Antibody
KC-24984-03 1 mL

SOX4 Antibody

Sign In for Pricing
View Details