TRIM29 Peptide - C-terminal region
TRIM29 Peptide - C-terminal region
Product Specifications
UniProt
B7Z8U9
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM29 Rabbit Polyclonal Antibody (orb573920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-M0185-01 5x 96 Tests
Uncoated Mouse GFAP (glial fibrillary acidic protein) ELISA Kit
Sign In for Pricing
View Details E-UNEL-M0185-02 15x 96 Tests
Uncoated Mouse GFAP (glial fibrillary acidic protein) ELISA Kit
Sign In for Pricing
View Details ![FADD Mouse Monoclonal Antibody [Clone ID: J1D2]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc36a/imageurl/am09009pu-n.webp)
HA751352 100 µL
Dopamine Transporter Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details