TRIM25 Peptide - C-terminal region
TRIM25 Peptide - C-terminal region
Product Specifications
UniProt
D3DTY9
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM25 Rabbit Polyclonal Antibody (orb574775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2982-100 1x 100 µL
GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), 0.2mg/mL
Sign In for Pricing
View Details 
BNCB2900-100 1x 100 µL
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472885-500 1x 500 µL
CD81 / TAPA-1 (C81/2885R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details