TRIM25 Peptide - C-terminal region
TRIM25 Peptide - C-terminal region
Product Specifications
UniProt
D3DTY9
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM25 Rabbit Polyclonal Antibody (orb574775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-H0778-01 24 Tests
Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit
Sign In for Pricing
View Details E-EL-H0778-02 48 Tests
Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit
Sign In for Pricing
View Details E-EL-H0778-03 96 Tests
Human COL3α1 (Collagen Type III Alpha 1) ELISA Kit
Sign In for Pricing
View Details 
