Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rel Peptide - C-terminal region

Rel Peptide - C-terminal region

Product Specifications

UniProt

P15307

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REL Rabbit Polyclonal Antibody (orb329897) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSCVDNGLMNEPGLSDDANNPTFVQSSHYSVNTLQSEQLSDPFTYGFFKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DDX58 (Thr170) Rabbit Polyclonal Antibody (BF647)
orb2412264 100 µL

Phospho-DDX58 (Thr170) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
DNAJC17 Blocking Peptide
MBS822725-01 1 mg

DNAJC17 Blocking Peptide

Sign In for Pricing
View Details
DNAJC17 Blocking Peptide
MBS822725-02 5 mg

DNAJC17 Blocking Peptide

Sign In for Pricing
View Details
DNAJC17 Blocking Peptide
MBS822725-03 5x 5 mg

DNAJC17 Blocking Peptide

Sign In for Pricing
View Details
IFNA1 Rabbit Polyclonal Antibody (FITC)
orb462302 100 µL

IFNA1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Cadonilimab Biosimilar - Research Grade
ICH5208-1g 1 g

Cadonilimab Biosimilar - Research Grade

Sign In for Pricing
View Details